DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ace2

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:47/175 - (26%)
Similarity:81/175 - (46%) Gaps:35/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CALLEEEDWEISEDEDARIDSA--SAADDDGKSDSK---KVAFECRECHKKYQRKGTFLRHMRTH 148
            |..::||     |....:|:||  |......:.|||   :::::.| |  |.:::.|.:    ..
pombe   372 CITVKEE-----EQLAPKIESADLSITPQVTEHDSKPPVRISYDHR-C--KTRKQSTRI----CR 424

  Fly   149 MDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSH--CAKTFAQQSTLQSHERTHTGERPFK 211
            :..::....||               ...|...|.|.:  |.|..|::..::||.:||..:||::
pombe   425 IPPETMASLYC---------------GPEADGKYVCLYNGCNKRIARKYNVESHIQTHLSDRPYR 474

  Fly   212 CSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNH 256
            |..|...|::..||:||:|.|.:.||:.| :|.|.|.|...|:.|
pombe   475 CDLCKAGFVRHHDLKRHLRIHENGRPYVC-ECLKRFNRLDALNRH 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 4/19 (21%)
C2H2 Zn finger 156..176 CDD:275368 2/19 (11%)
COG5048 <180..341 CDD:227381 29/79 (37%)
C2H2 Zn finger 184..204 CDD:275368 6/21 (29%)
zf-H2C2_2 197..219 CDD:290200 8/21 (38%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 12/24 (50%)
C2H2 Zn finger 240..260 CDD:275368 7/17 (41%)
zf-H2C2_2 252..276 CDD:290200 2/5 (40%)
C2H2 Zn finger 268..288 CDD:275368
C2H2 Zn finger 296..316 CDD:275368
C2H2 Zn finger 324..341 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 46/173 (27%)
C2H2 Zn finger 448..467 CDD:275368 5/18 (28%)
zf-C2H2 473..495 CDD:278523 8/21 (38%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
zf-H2C2_2 487..511 CDD:290200 12/24 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.