DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF25

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001316576.1 Gene:ZNF25 / 219749 HGNCID:13043 Length:460 Species:Homo sapiens


Alignment Length:285 Identity:99/285 - (34%)
Similarity:147/285 - (51%) Gaps:29/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CEESHQFYCRVRDEGIEDALCALLEEEDWEISEDEDARIDSASAADDDGKSDSK--------KV- 124
            |:|..:|:|:      :.||  ::.:......:..|        .|..|||.||        |: 
Human   124 CKECGKFFCQ------KSAL--IVHQHTHSKGKSYD--------CDKCGKSFSKNEDLIRHQKIH 172

  Fly   125 ----AFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECS 185
                .:||:||.|.:....:..||:|||...:.:.|..|:::|..:..|..|.|||...||:||:
Human   173 TRDKTYECKECKKIFYHLSSLSRHLRTHAGEKPYECNQCEKSFYQKPHLTEHQKTHTGEKPFECT 237

  Fly   186 HCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRK 250
            .|.|.|..::.|..|::|||||:|::|.:|.|.|.:.|.|..|.|.|..|:|:||.:|.|.|:|.
Human   238 ECGKFFYVKAYLMVHQKTHTGEKPYECKECGKAFSQKSHLTVHQRMHTGEKPYKCKECGKFFSRN 302

  Fly   251 FHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLV 315
            .||..|.||||||:|::|..|.|.|..|..|..|.|.|..::||.|:.|.|||...|.|.:|:..
Human   303 SHLKTHQRSHTGEKPYECKECRKCFYQKSALTVHQRTHTGEKPFECNKCGKTFYYKSDLTKHQRK 367

  Fly   316 HNAERTFKCPHCASFYKQRKTLARH 340
            |..|:.::|..|...:.....|..|
Human   368 HTGEKPYECTECGKSFAVNSVLRLH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 3/8 (38%)
C2H2 Zn finger 128..148 CDD:275368 7/19 (37%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 67/161 (42%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
zf-H2C2_2 197..219 CDD:290200 11/21 (52%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 11/24 (46%)
C2H2 Zn finger 240..260 CDD:275368 9/19 (47%)
zf-H2C2_2 252..276 CDD:290200 13/23 (57%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..341 CDD:275368 4/17 (24%)
ZNF25NP_001316576.1 KRAB 12..72 CDD:214630
KRAB 12..51 CDD:279668
C2H2 Zn finger 124..144 CDD:275368 6/27 (22%)
COG5048 148..457 CDD:227381 93/253 (37%)
C2H2 Zn finger 152..172 CDD:275368 7/19 (37%)
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
zf-H2C2_2 192..215 CDD:290200 7/22 (32%)
C2H2 Zn finger 208..228 CDD:275368 6/19 (32%)
zf-H2C2_2 220..243 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 248..273 CDD:290200 12/24 (50%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
zf-H2C2_2 276..301 CDD:290200 11/24 (46%)
C2H2 Zn finger 292..312 CDD:275368 9/19 (47%)
zf-H2C2_2 304..327 CDD:290200 13/22 (59%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 332..357 CDD:290200 11/24 (46%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
zf-H2C2_2 360..384 CDD:290200 6/23 (26%)
C2H2 Zn finger 376..396 CDD:275368 4/17 (24%)
zf-H2C2_2 389..413 CDD:290200 2/4 (50%)
C2H2 Zn finger 404..424 CDD:275368
C2H2 Zn finger 432..452 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.