DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ehn-3

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001023615.1 Gene:ehn-3 / 191363 WormBaseID:WBGene00001223 Length:262 Species:Caenorhabditis elegans


Alignment Length:246 Identity:60/246 - (24%)
Similarity:79/246 - (32%) Gaps:80/246 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTH-NAAKPYEC--SHCA 188
            :|..||:|:..|....||...|...:.|.|.:|:|.|.....:|.||.|| .....:||  :.|.
 Worm     3 KCDICHQKFSNKTNLNRHKVMHSGKKKFECQFCRRPFFRNDRMKEHMMTHIKKGNTFECPITACN 67

  Fly   189 KTFAQQSTLQSH---ERTHTGERPFKCSQCSKTFIKSSDLRRHIRT------------------- 231
            ..|...::||.|   |....|..|.||..|.|.|..|..|..|..|                   
 Worm    68 SKFNSFTSLQFHVDSEHIIRGSSPAKCKSCIKWFNSSHRLLLHFHTAHLDHTKFFSFKPAPILPK 132

  Fly   232 --------------------------------HG--SERPF-KCSKCTKT-------------FT 248
                                            |.  |:.|. :||:..|:             ..
 Worm   133 STTSILNPIKNPDDFDRIFDFFKTEIAPLFPLHSTVSQAPLPQCSRSVKSAKELSPTPSTEIETP 197

  Fly   249 RKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHC 299
            .:..||       |...:.|.:|...|..|.....||.||..|.||:||.|
 Worm   198 EEEELD-------GPESWYCDYCKIRFDDKVMWYLHSGLHSDDIPFKCSLC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 7/19 (37%)
C2H2 Zn finger 156..176 CDD:275368 7/19 (37%)
COG5048 <180..341 CDD:227381 42/192 (22%)
C2H2 Zn finger 184..204 CDD:275368 7/24 (29%)
zf-H2C2_2 197..219 CDD:290200 10/24 (42%)
C2H2 Zn finger 212..232 CDD:275368 8/70 (11%)
zf-H2C2_2 224..249 CDD:290200 9/91 (10%)
C2H2 Zn finger 240..260 CDD:275368 5/32 (16%)
zf-H2C2_2 252..276 CDD:290200 5/23 (22%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 3/4 (75%)
C2H2 Zn finger 324..341 CDD:275368
ehn-3NP_001023615.1 C2H2 Zn finger 4..24 CDD:275368 7/19 (37%)
C2H2 Zn finger 32..52 CDD:275368 7/19 (37%)
C2H2 Zn finger 61..80 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.