Sequence 1: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001023615.1 | Gene: | ehn-3 / 191363 | WormBaseID: | WBGene00001223 | Length: | 262 | Species: | Caenorhabditis elegans |
Alignment Length: | 246 | Identity: | 60/246 - (24%) |
---|---|---|---|
Similarity: | 79/246 - (32%) | Gaps: | 80/246 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 ECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTH-NAAKPYEC--SHCA 188
Fly 189 KTFAQQSTLQSH---ERTHTGERPFKCSQCSKTFIKSSDLRRHIRT------------------- 231
Fly 232 --------------------------------HG--SERPF-KCSKCTKT-------------FT 248
Fly 249 RKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHC 299 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | |
C2H2 Zn finger | 128..148 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 156..176 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <180..341 | CDD:227381 | 42/192 (22%) | ||
C2H2 Zn finger | 184..204 | CDD:275368 | 7/24 (29%) | ||
zf-H2C2_2 | 197..219 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 212..232 | CDD:275368 | 8/70 (11%) | ||
zf-H2C2_2 | 224..249 | CDD:290200 | 9/91 (10%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 5/32 (16%) | ||
zf-H2C2_2 | 252..276 | CDD:290200 | 5/23 (22%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 296..316 | CDD:275368 | 3/4 (75%) | ||
C2H2 Zn finger | 324..341 | CDD:275368 | |||
ehn-3 | NP_001023615.1 | C2H2 Zn finger | 4..24 | CDD:275368 | 7/19 (37%) |
C2H2 Zn finger | 32..52 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 61..80 | CDD:275368 | 5/18 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |