Sequence 1: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500033.1 | Gene: | znf-782 / 190310 | WormBaseID: | WBGene00021931 | Length: | 662 | Species: | Caenorhabditis elegans |
Alignment Length: | 305 | Identity: | 100/305 - (32%) |
---|---|---|---|
Similarity: | 135/305 - (44%) | Gaps: | 44/305 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 ESHQFYCRVRDEGIEDALCALLEEEDWEISEDEDARIDSA----SAADDDGKSDSKKVAFECREC 131
Fly 132 HKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQST 196
Fly 197 LQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRT-HGSERPFKCSKCTKTFTRKFHLDNHFRSH 260
Fly 261 TGERPFKCSHCPKAFAMKQ----HLKQ--------------------------HSRLHLPDRPFR 295
Fly 296 CSHCPKTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARH 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | 2/6 (33%) |
C2H2 Zn finger | 128..148 | CDD:275368 | 1/19 (5%) | ||
C2H2 Zn finger | 156..176 | CDD:275368 | 5/19 (26%) | ||
COG5048 | <180..341 | CDD:227381 | 72/192 (38%) | ||
C2H2 Zn finger | 184..204 | CDD:275368 | 13/19 (68%) | ||
zf-H2C2_2 | 197..219 | CDD:290200 | 16/21 (76%) | ||
C2H2 Zn finger | 212..232 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 224..249 | CDD:290200 | 8/25 (32%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 252..276 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 12/49 (24%) | ||
C2H2 Zn finger | 296..316 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 324..341 | CDD:275368 | 5/17 (29%) | ||
znf-782 | NP_500033.1 | C2H2 Zn finger | 106..126 | CDD:275368 | 5/19 (26%) |
zf-H2C2_2 | 119..143 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 134..154 | CDD:275368 | 13/19 (68%) | ||
zf-H2C2_2 | 147..171 | CDD:290200 | 18/23 (78%) | ||
C2H2 Zn finger | 162..180 | CDD:275368 | 6/17 (35%) | ||
COG5048 | <187..404 | CDD:227381 | 41/135 (30%) | ||
C2H2 Zn finger | 191..211 | CDD:275370 | 6/19 (32%) | ||
C2H2 Zn finger | 218..239 | CDD:275368 | 10/20 (50%) | ||
C2H2 Zn finger | 248..268 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 260..285 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 276..296 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 288..313 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 304..324 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 386..403 | CDD:275368 | |||
C2H2 Zn finger | 424..441 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |