| Sequence 1: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001360586.1 | Gene: | ztf-14 / 187492 | WormBaseID: | WBGene00010936 | Length: | 483 | Species: | Caenorhabditis elegans |
| Alignment Length: | 270 | Identity: | 62/270 - (22%) |
|---|---|---|---|
| Similarity: | 105/270 - (38%) | Gaps: | 84/270 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 51 ICPQCYEDVKSAYGIRQTCEESHQFYCRVRDEGIEDALCALLEEEDWEIS--------------- 100
Fly 101 -----------EDEDAR---IDSASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDG 151
Fly 152 QSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCS--Q 214
Fly 215 CSKTFIKSSDLRRHI-RTHGSERPFKC--SKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFA 276
Fly 277 MKQHLKQHSR 286 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | 6/26 (23%) |
| C2H2 Zn finger | 128..148 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 156..176 | CDD:275368 | 2/19 (11%) | ||
| COG5048 | <180..341 | CDD:227381 | 38/112 (34%) | ||
| C2H2 Zn finger | 184..204 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 197..219 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 212..232 | CDD:275368 | 8/22 (36%) | ||
| zf-H2C2_2 | 224..249 | CDD:290200 | 9/27 (33%) | ||
| C2H2 Zn finger | 240..260 | CDD:275368 | 5/21 (24%) | ||
| zf-H2C2_2 | 252..276 | CDD:290200 | 5/23 (22%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | |||
| C2H2 Zn finger | 324..341 | CDD:275368 | |||
| ztf-14 | NP_001360586.1 | zf-H2C2_2 | 260..285 | CDD:372612 | 8/24 (33%) |
| zf-C2H2 | 274..296 | CDD:333835 | 7/21 (33%) | ||
| C2H2 Zn finger | 276..296 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 288..315 | CDD:372612 | 13/26 (50%) | ||
| SFP1 | <298..358 | CDD:227516 | 21/68 (31%) | ||
| C2H2 Zn finger | 304..327 | CDD:275368 | 8/22 (36%) | ||
| C2H2 Zn finger | 335..355 | CDD:275368 | 5/19 (26%) | ||
| VI_FHA | <388..>478 | CDD:274537 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||