DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and Y5F2A.4

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_502063.1 Gene:Y5F2A.4 / 178004 WormBaseID:WBGene00012385 Length:454 Species:Caenorhabditis elegans


Alignment Length:236 Identity:63/236 - (26%)
Similarity:98/236 - (41%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ECRECHKKYQRKGTFLRH-MRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHN---AAKPYECSHC 187
            :|::|.|.:..|....:| :|.|                     |..:|:.|   |:.|.:||.|
 Worm     5 KCQDCGKTFDLKRYLTKHELRMH---------------------KNVVKSKNDRSASDPLKCSMC 48

  Fly   188 AKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERP------FKCSKCTK- 245
            .|.|.:.|.||.|:.||...|.:.|:.|.:.|::.|.|.||:....|..|      ..|.||.: 
 Worm    49 DKVFPRLSHLQRHQMTHLNVRNYSCTFCEEKFVQKSHLTRHVSRKHSNAPGVEVDWTACDKCGQL 113

  Fly   246 ---TFTRKFHLDNHFRSHTGERPFKCSHCPKAF-AMKQHLKQHSRLHLPDRPFR--CSHCPKTFR 304
               |:..:.|...:...|      ||..|.:.. |....|::|   |:..|.:.  |..|..:|.
 Worm   114 FKTTYEMRIHRQTYHELH------KCKQCQEVIEAGSDGLRKH---HMQCRKYSNVCDECGASFS 169

  Fly   305 LSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIH 345
            ..:.|..|:.....:..|.|..|.|:::||..|.|||.:.|
 Worm   170 RPADLVSHETSCLKKFAFVCKPCDSYFRQRVQLDRHIKKAH 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 6/20 (30%)
C2H2 Zn finger 156..176 CDD:275368 2/19 (11%)
COG5048 <180..341 CDD:227381 49/173 (28%)
C2H2 Zn finger 184..204 CDD:275368 9/19 (47%)
zf-H2C2_2 197..219 CDD:290200 8/21 (38%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 9/34 (26%)
C2H2 Zn finger 240..260 CDD:275368 5/23 (22%)
zf-H2C2_2 252..276 CDD:290200 5/24 (21%)
C2H2 Zn finger 268..288 CDD:275368 5/20 (25%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
C2H2 Zn finger 324..341 CDD:275368 7/16 (44%)
Y5F2A.4NP_502063.1 C2H2 Zn finger 6..27 CDD:275368 6/20 (30%)
zf-C2H2 44..65 CDD:278523 9/20 (45%)
C2H2 Zn finger 45..65 CDD:275368 9/19 (47%)
C2H2 Zn finger 73..94 CDD:275368 7/20 (35%)
C2H2 Zn finger 107..126 CDD:275368 5/18 (28%)
C2H2 Zn finger 161..181 CDD:275368 5/19 (26%)
C2H2 Zn finger 189..212 CDD:275368 10/22 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.