Sequence 1: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502063.1 | Gene: | Y5F2A.4 / 178004 | WormBaseID: | WBGene00012385 | Length: | 454 | Species: | Caenorhabditis elegans |
Alignment Length: | 236 | Identity: | 63/236 - (26%) |
---|---|---|---|
Similarity: | 98/236 - (41%) | Gaps: | 47/236 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 ECRECHKKYQRKGTFLRH-MRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHN---AAKPYECSHC 187
Fly 188 AKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERP------FKCSKCTK- 245
Fly 246 ---TFTRKFHLDNHFRSHTGERPFKCSHCPKAF-AMKQHLKQHSRLHLPDRPFR--CSHCPKTFR 304
Fly 305 LSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIH 345 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | |
C2H2 Zn finger | 128..148 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 156..176 | CDD:275368 | 2/19 (11%) | ||
COG5048 | <180..341 | CDD:227381 | 49/173 (28%) | ||
C2H2 Zn finger | 184..204 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 197..219 | CDD:290200 | 8/21 (38%) | ||
C2H2 Zn finger | 212..232 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 224..249 | CDD:290200 | 9/34 (26%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 5/23 (22%) | ||
zf-H2C2_2 | 252..276 | CDD:290200 | 5/24 (21%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 296..316 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 324..341 | CDD:275368 | 7/16 (44%) | ||
Y5F2A.4 | NP_502063.1 | C2H2 Zn finger | 6..27 | CDD:275368 | 6/20 (30%) |
zf-C2H2 | 44..65 | CDD:278523 | 9/20 (45%) | ||
C2H2 Zn finger | 45..65 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 73..94 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 107..126 | CDD:275368 | 5/18 (28%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 189..212 | CDD:275368 | 10/22 (45%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |