DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and blmp-1

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001251370.1 Gene:blmp-1 / 172917 WormBaseID:WBGene00003847 Length:817 Species:Caenorhabditis elegans


Alignment Length:136 Identity:58/136 - (42%)
Similarity:75/136 - (55%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 NAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCS 241
            |....|.|..|.|||.|.|.|:.|.|||||||||||..|:|.|.:.:.|::|...|..|||.:|.
 Worm   503 NGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCD 567

  Fly   242 KCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLS 306
            .|.|.|:...:|..|.|.|.|::|:.|..|...|....||:.|.|||..:||:.|..|.|.:...
 Worm   568 ICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISP 632

  Fly   307 STLKEH 312
            |.|:.|
 Worm   633 SGLRTH 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368
C2H2 Zn finger 156..176 CDD:275368
COG5048 <180..341 CDD:227381 57/133 (43%)
C2H2 Zn finger 184..204 CDD:275368 10/19 (53%)
zf-H2C2_2 197..219 CDD:290200 15/21 (71%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
zf-H2C2_2 224..249 CDD:290200 10/24 (42%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-H2C2_2 252..276 CDD:290200 8/23 (35%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 6/17 (35%)
C2H2 Zn finger 324..341 CDD:275368
blmp-1NP_001251370.1 SET 119..247 CDD:214614
zf-C2H2 508..530 CDD:278523 11/21 (52%)
C2H2 Zn finger 510..530 CDD:275368 10/19 (53%)
zf-H2C2_2 522..547 CDD:290200 16/24 (67%)
C2H2 Zn finger 538..558 CDD:275368 6/19 (32%)
zf-H2C2_2 550..575 CDD:290200 10/24 (42%)
C2H2 Zn finger 566..586 CDD:275368 7/19 (37%)
zf-H2C2_2 578..603 CDD:290200 9/24 (38%)
C2H2 Zn finger 594..614 CDD:275368 7/19 (37%)
zf-H2C2_2 606..631 CDD:290200 11/24 (46%)
ARS2 <620..772 CDD:282772 6/19 (32%)
C2H2 Zn finger 622..641 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.