DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF782

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001001662.1 Gene:ZNF782 / 158431 HGNCID:33110 Length:699 Species:Homo sapiens


Alignment Length:251 Identity:95/251 - (37%)
Similarity:139/251 - (55%) Gaps:28/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KSDSKKVAFECRECHKKYQRKGTFLRHMRTH-------MDG---------------------QSF 154
            ||.:.:..:||.||.|.:..|....:|.|||       .||                     :.|
Human   386 KSHTGEKPYECPECGKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRTHTGEKPF 450

  Fly   155 PCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTF 219
            .|..|.::|..:..|..|.:||...||:||:.|.|:|:..|.|::|.||||||||:||.:|.|.|
Human   451 ECHECGKSFNYKSILIVHQRTHTGEKPFECNECGKSFSHMSGLRNHRRTHTGERPYKCDECGKAF 515

  Fly   220 IKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQH 284
            ...|.||:|.|||..|:|:||::|.|.|.:|..|..|.|.||||:|:||:||.:||:.|.:|:.|
Human   516 KLKSGLRKHHRTHTGEKPYKCNQCGKAFGQKSQLRGHHRIHTGEKPYKCNHCGEAFSQKSNLRVH 580

  Fly   285 SRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARH 340
            .|.|..::|::|..|.||||..|.|:.|:..|..|:.::|..|...:.::..|.:|
Human   581 HRTHTGEKPYQCEECGKTFRQKSNLRGHQRTHTGEKPYECNECGKAFSEKSVLRKH 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 7/19 (37%)
C2H2 Zn finger 156..176 CDD:275368 5/19 (26%)
COG5048 <180..341 CDD:227381 73/161 (45%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 14/21 (67%)
C2H2 Zn finger 212..232 CDD:275368 9/19 (47%)
zf-H2C2_2 224..249 CDD:290200 13/24 (54%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
zf-H2C2_2 252..276 CDD:290200 13/23 (57%)
C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
C2H2 Zn finger 324..341 CDD:275368 4/17 (24%)
ZNF782NP_001001662.1 KRAB 8..67 CDD:214630
KRAB 8..47 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..95
C2H2 Zn finger 291..307 CDD:275368
C2H2 Zn finger 314..332 CDD:275368
C2H2 Zn finger 343..360 CDD:275368
C2H2 Zn finger 369..388 CDD:275368 1/1 (100%)
COG5048 392..697 CDD:227381 93/245 (38%)
C2H2 Zn finger 396..416 CDD:275368 7/19 (37%)
zf-H2C2_2 409..432 CDD:290200 6/22 (27%)
C2H2 Zn finger 424..444 CDD:275368 2/19 (11%)
zf-H2C2_2 437..461 CDD:290200 4/23 (17%)
C2H2 Zn finger 452..472 CDD:275368 5/19 (26%)
zf-H2C2_2 465..489 CDD:290200 11/23 (48%)
C2H2 Zn finger 480..500 CDD:275368 8/19 (42%)
zf-H2C2_2 493..516 CDD:290200 14/22 (64%)
C2H2 Zn finger 508..528 CDD:275368 9/19 (47%)
zf-H2C2_2 521..543 CDD:290200 12/21 (57%)
C2H2 Zn finger 536..556 CDD:275368 8/19 (42%)
zf-H2C2_2 549..573 CDD:290200 14/23 (61%)
C2H2 Zn finger 564..584 CDD:275368 9/19 (47%)
zf-H2C2_2 576..601 CDD:290200 10/24 (42%)
C2H2 Zn finger 592..612 CDD:275368 9/19 (47%)
zf-H2C2_2 604..628 CDD:290200 6/23 (26%)
C2H2 Zn finger 620..640 CDD:275368 4/17 (24%)
zf-H2C2_2 633..657 CDD:290200 2/4 (50%)
C2H2 Zn finger 648..668 CDD:275368
zf-H2C2_2 660..685 CDD:290200
C2H2 Zn finger 676..696 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.