DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and si:dkey-122c11.8

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_017211097.1 Gene:si:dkey-122c11.8 / 108183696 ZFINID:ZDB-GENE-110913-23 Length:358 Species:Danio rerio


Alignment Length:285 Identity:89/285 - (31%)
Similarity:147/285 - (51%) Gaps:14/285 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EDVKSAYGIRQTCEESHQFYCRVRDEGIEDALCALLEEEDWEISEDEDARIDSASAADDDGKSDS 121
            ||::....:....|::||     ::|         :||:..:::.||...:...:.:....:...
Zfish    22 EDLQEQTDLMLLKEKTHQ-----QNE---------MEEKQQDMTTDEKPTLTKKTLSRGRPRKSK 72

  Fly   122 KKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSH 186
            .:..|.|::|.|.:.:|.....|:|.|...:::.|..|.::|.....|..||:.|...:||.|..
Zfish    73 PRCNFSCKQCGKSFSQKPKLDVHIRDHTREKAYTCKQCGKSFYNTRNLTVHMRIHTGERPYTCQQ 137

  Fly   187 CAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKF 251
            |.|:|.:...|..|.|.||||||:.|.||.|:|..:.:|..|:|.|..|:|:.|.:|.|::::..
Zfish   138 CGKSFHKTGNLTVHLRIHTGERPYTCQQCGKSFQTTGNLTVHMRIHTGEKPYSCPQCGKSYSQNS 202

  Fly   252 HLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVH 316
            :|:.|.|:|.|.|.|.|:.|.|.|..||:|..|.|:|..::|:.|:.|.|:|...||||.|.:||
Zfish   203 NLEVHMRTHNGGRTFVCTQCGKRFVKKQNLDLHMRIHTGEKPYTCTECGKSFPYKSTLKHHMIVH 267

  Fly   317 NAERTFKCPHCASFYKQRKTLARHI 341
            ..|:.|.|..|...:.....|..|:
Zfish   268 TGEKPFACAQCGKSFTCNANLRNHM 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 5/20 (25%)
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 63/160 (39%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
zf-H2C2_2 197..219 CDD:290200 13/21 (62%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 9/24 (38%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-H2C2_2 252..276 CDD:290200 10/23 (43%)
C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
C2H2 Zn finger 324..341 CDD:275368 3/16 (19%)
si:dkey-122c11.8XP_017211097.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.