DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and LOC100148466

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001314792.1 Gene:LOC100148466 / 100148466 -ID:- Length:321 Species:Danio rerio


Alignment Length:284 Identity:97/284 - (34%)
Similarity:137/284 - (48%) Gaps:30/284 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LLEEEDWEISEDEDARIDSASAADDDG---------------------KSDSK--------KVAF 126
            |:||.:....|:...:|:..:....||                     |.|.|        |..|
Zfish    30 LIEENEGSKEEEHHVKIEEKNNLQTDGFLKRRDKNHFTCTQCGTSFGRKRDLKIHRRIHTGKKPF 94

  Fly   127 ECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTF 191
            .|.:|...:.......:|||.|...:.|.|..|:::|.....|..||:.:...||:.|:.|.|.|
Zfish    95 TCTQCGNSFNSSSHLNQHMRIHTGEKPFTCTQCEKSFSQSSNLNLHMRIYTREKPFTCTQCGKNF 159

  Fly   192 AQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNH 256
            .|.|.|..|.|.||||:||.|:||..:||:||.|..||.:|..|:||.|::|.::|.|..||:.|
Zfish   160 NQSSNLNRHMRIHTGEKPFTCTQCGTSFIRSSSLNLHIMSHNGEKPFTCTQCGRSFNRSSHLNRH 224

  Fly   257 FRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERT 321
            ...||||:||.|:.|..:|:...:|..|.|:|..::||.|..|..:|..||.|..|..||..|:.
Zfish   225 MMIHTGEKPFTCTQCGMSFSQSSNLNLHMRIHTGEKPFACPQCGMSFSQSSNLNLHMRVHTGEKP 289

  Fly   322 FKCPHCASFYKQRKTLARHILEIH 345
            |.||.|...:.....|.|| :.||
Zfish   290 FTCPQCGKSFNSSSHLNRH-MRIH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 5/19 (26%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 69/160 (43%)
C2H2 Zn finger 184..204 CDD:275368 9/19 (47%)
zf-H2C2_2 197..219 CDD:290200 12/21 (57%)
C2H2 Zn finger 212..232 CDD:275368 10/19 (53%)
zf-H2C2_2 224..249 CDD:290200 10/24 (42%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-H2C2_2 252..276 CDD:290200 11/23 (48%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
C2H2 Zn finger 324..341 CDD:275368 5/16 (31%)
LOC100148466NP_001314792.1 C2H2 Zn finger 68..88 CDD:275368 3/19 (16%)
COG5048 <77..320 CDD:227381 90/237 (38%)
zf-H2C2_2 80..105 CDD:290200 6/24 (25%)
C2H2 Zn finger 96..116 CDD:275368 5/19 (26%)
zf-H2C2_2 108..133 CDD:290200 8/24 (33%)
C2H2 Zn finger 124..144 CDD:275368 6/19 (32%)
zf-C2H2 150..172 CDD:278523 9/21 (43%)
C2H2 Zn finger 152..172 CDD:275368 9/19 (47%)
zf-H2C2_2 164..189 CDD:290200 13/24 (54%)
C2H2 Zn finger 180..200 CDD:275368 10/19 (53%)
zf-C2H2 206..228 CDD:278523 8/21 (38%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 220..245 CDD:290200 12/24 (50%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 248..273 CDD:290200 9/24 (38%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 276..301 CDD:290200 9/24 (38%)
C2H2 Zn finger 292..312 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.