DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and AT1G70600

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_177217.1 Gene:AT1G70600 / 843397 AraportID:AT1G70600 Length:146 Species:Arabidopsis thaliana


Alignment Length:146 Identity:98/146 - (67%)
Similarity:111/146 - (76%) Gaps:8/146 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFR 71
            ||.||.|||||.||||||||||||||||||||||||||.|||||||||||||||.||..|...|.
plant     6 KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFFC 70

  Fly    72 PEINLDKLWSLVGAEKFAELEKEKSTK--APVIDLVKFGYYKLLGRGHLPA-RPVIVKAKYFSKK 133
            |.:|||||||||     .|..|.||||  .|:||:.:.|::|:||:||||. :|.:||||..||.
plant    71 PIVNLDKLWSLV-----PEDVKAKSTKDNVPLIDVTQHGFFKVLGKGHLPENKPFVVKAKLISKT 130

  Fly   134 AEDKIKKAGGVCLLSA 149
            ||.|||:|||..:|:|
plant   131 AEKKIKEAGGAVVLTA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 97/144 (67%)
AT1G70600NP_177217.1 PTZ00160 1..146 CDD:185489 97/144 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1397
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115477
Inparanoid 1 1.050 193 1.000 Inparanoid score I1363
OMA 1 1.010 - - QHG53607
OrthoDB 1 1.010 - - D1445443at2759
OrthoFinder 1 1.000 - - FOG0001387
OrthoInspector 1 1.000 - - otm3442
orthoMCL 1 0.900 - - OOG6_100748
Panther 1 1.100 - - O PTHR11721
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1116
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.