DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and RPL15

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_189221.1 Gene:RPL15 / 822189 AraportID:AT3G25920 Length:277 Species:Arabidopsis thaliana


Alignment Length:169 Identity:45/169 - (26%)
Similarity:68/169 - (40%) Gaps:52/169 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRKKTRKLRGHVSHGHG-------RIGKHRKHP-------GG-----------RGNAGGMHHHRI 44
            ::|:.||.|| :|.|.|       |..|.|..|       ||           ||.||||   |.
plant    93 RKKQKRKGRG-ISAGQGASCGFGMRGQKSRSGPGIMRGFEGGQTALYRRLPKLRGIAGGM---RS 153

  Fly    45 NFDKYHPGYFGKVGMRNFHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGY 109
            ...||.|.....:....|      :...|::|:.|     .:|.......:..|.|:        
plant   154 GLPKYLPVNIKDIETAGF------QEGDEVSLETL-----KQKGLINPSGRERKLPL-------- 199

  Fly   110 YKLLGRGHLPARPVIVKAKYFSKKAEDKIKKAGGVCLLS 148
             |:||.|.|..: :..||:.||.:|::|::.:|  |.|:
plant   200 -KILGTGELSMK-LTFKARAFSTQAKEKLEASG--CTLT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 45/167 (27%)
RPL15NP_189221.1 rplO 82..236 CDD:235523 45/169 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.