DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and LOC690246

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_017447742.1 Gene:LOC690246 / 690246 RGDID:1582864 Length:130 Species:Rattus norvegicus


Alignment Length:118 Identity:67/118 - (56%)
Similarity:87/118 - (73%) Gaps:4/118 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AGGM----HHHRINFDKYHPGYFGKVGMRNFHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKS 96
            |.||    ::|||||||||||||||||||::||:|...|.|.:||||||.||..:......|.|:
  Rat    13 AVGMLEARNYHRINFDKYHPGYFGKVGMRHYHLKRSQSFCPTVNLDKLWMLVSEQTRVNAVKNKT 77

  Fly    97 TKAPVIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKAEDKIKKAGGVCLLSA 149
            ..||:.|:|:.||||:|.:|.||.:|||||||:||::||:|:|..||.|:|.|
  Rat    78 GAAPITDIVRSGYYKVLRKGKLPKQPVIVKAKFFSRRAEEKMKGVGGACVLVA 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 66/116 (57%)
LOC690246XP_017447742.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445443at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.