DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and rpl27a

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_956324.1 Gene:rpl27a / 336726 ZFINID:ZDB-GENE-030131-8670 Length:148 Species:Danio rerio


Alignment Length:145 Identity:98/145 - (67%)
Similarity:121/145 - (83%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHK 69
            |:.|||||||||||||||:|||||||||||||||:|||||||||||||||||||||::||:|...
Zfish     4 KKSKTRKLRGHVSHGHGRVGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMRHYHLKRNTT 68

  Fly    70 FRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKA 134
            |.|.|||||||:||..:......::....||:||:|:.||:|:||:|.||.:|||||||:||::|
Zfish    69 FCPTINLDKLWTLVSEQTRVNYSQKPDGPAPIIDVVRAGYFKVLGKGKLPKQPVIVKAKFFSRRA 133

  Fly   135 EDKIKKAGGVCLLSA 149
            |:|||..||.|:|:|
Zfish   134 EEKIKGVGGACVLTA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 96/141 (68%)
rpl27aNP_956324.1 PTZ00160 1..148 CDD:185489 97/143 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H115477
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445443at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.