DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and Mrpl15

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_006237867.1 Gene:Mrpl15 / 297799 RGDID:1304796 Length:295 Species:Rattus norvegicus


Alignment Length:179 Identity:43/179 - (24%)
Similarity:68/179 - (37%) Gaps:64/179 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNIK-----RKKTRKLRGHVSHGHGRIGKH--RKHPGGR--------GNAGGMHHHRINFDKYH 50
            ::|:|     ||:.|:.|..      |.|:.  |.|.|.|        |..||.....|...|| 
  Rat    23 LANLKPSLNSRKRERRPRDR------RRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKY- 80

  Fly    51 PGYFGKVGMRNFHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGR 115
                   |....|..| |:::| ::|.:|..|:      :|.:...|:.  |||.:.    :.||
  Rat    81 -------GFNEGHSFR-HQYQP-LSLRRLQYLI------DLGRVDPTQP--IDLTQL----VNGR 124

  Fly   116 GHLPARP--------------------VIVKAKYFSKKAEDKIKKAGGV 144
            | :..:|                    |.::.:..|:.|...|:|.|||
  Rat   125 G-VTIQPLKRDYGVQLVEEGADTFQAKVNIEVQMASELAIAAIEKNGGV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 40/168 (24%)
Mrpl15XP_006237867.1 Ribosomal_L27A 52..175 CDD:395666 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.