DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and RGD1560633

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_038951387.1 Gene:RGD1560633 / 292474 RGDID:1560633 Length:148 Species:Rattus norvegicus


Alignment Length:143 Identity:88/143 - (61%)
Similarity:114/143 - (79%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFR 71
            :||.||:|:||||||.|||.||||||.|||||:|||||||||||||||||||||::||:|...|.
  Rat     6 RKTGKLQGYVSHGHGLIGKDRKHPGGLGNAGGVHHHRINFDKYHPGYFGKVGMRHYHLKRNQSFS 70

  Fly    72 PEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKAED 136
            |.:||||||:.|..:......:.|:..||:||:|:.||:|:||:|.||.:||:||||:||::||:
  Rat    71 PTVNLDKLWTSVSQQTRVNAARNKTGAAPIIDVVRSGYHKVLGQGKLPKQPVMVKAKFFSRRAEE 135

  Fly   137 KIKKAGGVCLLSA 149
            |:|..|..|:|.|
  Rat   136 KVKGVGSACVLVA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 87/141 (62%)
RGD1560633XP_038951387.1 PTZ00160 1..148 CDD:185489 87/141 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340570
Domainoid 1 1.000 179 1.000 Domainoid score I3435
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3392
OMA 1 1.010 - - QHG53607
OrthoDB 1 1.010 - - D1445443at2759
OrthoFinder 1 1.000 - - FOG0001387
OrthoInspector 1 1.000 - - otm46100
orthoMCL 1 0.900 - - OOG6_100748
Panther 1 1.100 - - O PTHR11721
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1116
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.