DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and Rpl27a

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_036105.2 Gene:Rpl27a / 26451 MGIID:1347076 Length:148 Species:Mus musculus


Alignment Length:143 Identity:101/143 - (70%)
Similarity:120/143 - (83%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFR 71
            :|||||||||||||||||||||||||||||||||||||||||||||||||||||::||:|...|.
Mouse     6 RKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKRNQSFC 70

  Fly    72 PEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKAED 136
            |.:||||||:||..:......|.|:..||:||:|:.||||:||:|.||.:|||||||:||::||:
Mouse    71 PTVNLDKLWTLVSEQTRVNAAKNKTGVAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEE 135

  Fly   137 KIKKAGGVCLLSA 149
            |||..||.|:|.|
Mouse   136 KIKGVGGACVLVA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 100/141 (71%)
Rpl27aNP_036105.2 PTZ00160 1..148 CDD:185489 100/141 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37 29/30 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836862
Domainoid 1 1.000 179 1.000 Domainoid score I3527
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115477
Inparanoid 1 1.050 227 1.000 Inparanoid score I3469
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53607
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001387
OrthoInspector 1 1.000 - - oto94728
orthoMCL 1 0.900 - - OOG6_100748
Panther 1 1.100 - - LDO PTHR11721
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1123
SonicParanoid 1 1.000 - - X1116
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.