DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and rpl2801

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_596326.1 Gene:rpl2801 / 2541130 PomBaseID:SPBC776.11 Length:148 Species:Schizosaccharomyces pombe


Alignment Length:142 Identity:87/142 - (61%)
Similarity:110/142 - (77%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFRP 72
            ||||||||||.||||||||||||||||.|||:.|.|.:|||||||||||||||.|||.:...:||
pombe     7 KTRKLRGHVSAGHGRIGKHRKHPGGRGKAGGLQHLRSHFDKYHPGYFGKVGMRRFHLMKNPLWRP 71

  Fly    73 EINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKAEDK 137
            .:|||:||:||..|...:...:.:..||||::::.||.|:||:|.||..|||::.:|.|::||:|
pombe    72 TVNLDRLWTLVPNETREKYLGKNTEVAPVINVLQSGYGKVLGKGRLPDTPVIIQTRYVSRRAEEK 136

  Fly   138 IKKAGGVCLLSA 149
            ||:||||..|.|
pombe   137 IKQAGGVVELIA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 86/140 (61%)
rpl2801NP_596326.1 PTZ00160 1..148 CDD:185489 86/140 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1169
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115477
Inparanoid 1 1.050 185 1.000 Inparanoid score I1080
OMA 1 1.010 - - QHG53607
OrthoFinder 1 1.000 - - FOG0001387
OrthoInspector 1 1.000 - - otm47371
orthoMCL 1 0.900 - - OOG6_100748
Panther 1 1.100 - - O PTHR11721
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1123
SonicParanoid 1 1.000 - - X1116
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.