DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and AgaP_AGAP011946

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_320585.1 Gene:AgaP_AGAP011946 / 1280723 VectorBaseID:AGAP011946 Length:285 Species:Anopheles gambiae


Alignment Length:174 Identity:33/174 - (18%)
Similarity:64/174 - (36%) Gaps:54/174 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNIKRKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFD----------KYHPGYFG 55
            :.||:.....|  .:|..|.|:.|..:...|.:|:....::.|:.::          .|.|.|.|
Mosquito    22 IGNIRDNPQSK--QNVKRGRGQHGGDKHGAGNKGSGQRQNYMRLGYETGNTPFYMRFSYEPYYKG 84

  Fly    56 KVGMRNFHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPA 120
                  .||:|::   |.::|.:|..|:..::.       ..:|| |||.     .:...|....
Mosquito    85 ------HHLKREY---PPVSLHQLQKLIDTDRL-------DHRAP-IDLT-----TICNTGLFEV 127

  Fly   121 RP--------------------VIVKAKYFSKKAEDKIKKAGGV 144
            ||                    :.::.::..:.....|::.|||
Mosquito   128 RPDLLHHGVQLTDEGADDFKAKINIEVQHAPESVIAAIERNGGV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 31/168 (18%)
AgaP_AGAP011946XP_320585.1 Ribosomal_L18e 44..174 CDD:279201 26/150 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.