DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and LOC108351703

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_017451517.1 Gene:LOC108351703 / 108351703 RGDID:11463616 Length:148 Species:Rattus norvegicus


Alignment Length:143 Identity:94/143 - (65%)
Similarity:117/143 - (81%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFR 71
            :||.||||||||||||||||||||||||||||:||:|||.||||||||||.|||::||:|...|.
  Rat     6 RKTWKLRGHVSHGHGRIGKHRKHPGGRGNAGGVHHYRINSDKYHPGYFGKAGMRHYHLKRNQSFC 70

  Fly    72 PEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKAED 136
            |.:||||||:||..:......|.|:..||:||:|:.||||:||:|.||.:||:||||:||::||:
  Rat    71 PTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVMVKAKFFSRRAEE 135

  Fly   137 KIKKAGGVCLLSA 149
            |:|..||.|:|.|
  Rat   136 KMKGVGGACVLVA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 93/141 (66%)
LOC108351703XP_017451517.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340575
Domainoid 1 1.000 179 1.000 Domainoid score I3435
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3392
OMA 1 1.010 - - QHG53607
OrthoDB 1 1.010 - - D1445443at2759
OrthoFinder 1 1.000 - - FOG0001387
OrthoInspector 1 1.000 - - otm46100
orthoMCL 1 0.900 - - OOG6_100748
Panther 1 1.100 - - O PTHR11721
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1116
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.