DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and LOC103691294

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_017445971.2 Gene:LOC103691294 / 103691294 RGDID:9107141 Length:304 Species:Rattus norvegicus


Alignment Length:94 Identity:62/94 - (65%)
Similarity:71/94 - (75%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFR 71
            :||.||||||||.|||||||.|.|||||||||.||||||.||:|||:|||.|||::||:|...|.
  Rat   185 RKTWKLRGHVSHSHGRIGKHGKRPGGRGNAGGEHHHRINSDKHHPGHFGKAGMRHYHLKRNQSFC 249

  Fly    72 PEINLDKLWSLVGAEKFAELEKEKSTKAP 100
            |..||||||:||..:..|...|.|:..||
  Rat   250 PTANLDKLWTLVSEQTRANAAKNKTGAAP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 62/94 (66%)
LOC103691294XP_017445971.2 Ribosomal_L27A 181..>277 CDD:416408 60/91 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445443at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.