DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27A and rpl27a

DIOPT Version :9

Sequence 1:NP_001188689.2 Gene:RpL27A / 33654 FlyBaseID:FBgn0285948 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_031760728.1 Gene:rpl27a / 100170552 XenbaseID:XB-GENE-5853519 Length:165 Species:Xenopus tropicalis


Alignment Length:145 Identity:101/145 - (69%)
Similarity:117/145 - (80%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHK 69
            |.:|||||||||||||||||||||||||||||||||||||||||||||||||||||::||::...
 Frog    21 KLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKKNQS 85

  Fly    70 FRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKA 134
            |.|.|||||||:||..:......|.....||:|:.|..||||:||:|.||.:|||||||:||:||
 Frog    86 FCPTINLDKLWTLVSEQTRLNHAKNPEGPAPIINAVHAGYYKVLGKGKLPKQPVIVKAKFFSRKA 150

  Fly   135 EDKIKKAGGVCLLSA 149
            |:|||..||.|:|.|
 Frog   151 EEKIKSVGGACVLVA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27ANP_001188689.2 PTZ00160 7..149 CDD:185489 99/141 (70%)
rpl27aXP_031760728.1 PTZ00160 19..165 CDD:185489 100/143 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3660
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H115477
Inparanoid 1 1.050 222 1.000 Inparanoid score I3444
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445443at2759
OrthoFinder 1 1.000 - - FOG0001387
OrthoInspector 1 1.000 - - oto104919
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1123
SonicParanoid 1 1.000 - - X1116
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.