DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1l and GPP2

DIOPT Version :9

Sequence 1:NP_477228.1 Gene:Gs1l / 33653 FlyBaseID:FBgn0019982 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_010984.3 Gene:GPP2 / 856791 SGDID:S000000864 Length:250 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:54/203 - (26%)
Similarity:92/203 - (45%) Gaps:34/203 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVTHCVFDMDGLLLDTERLYTVATEMILEPYGKTYPFEIKEQVM----GLQT-EPLARFMVEHYE 67
            ||...:||:||.::.::    .|.......:||..|:...|.|:    |.:| :.:|:|..:   
Yeast    11 KVNAALFDVDGTIIISQ----PAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKFAPD--- 68

  Fly    68 LPMSWEEYARQQRANTEILMRNAQL-MPGAERLLRHLHA-NKVPFCLATSSGADMVELKTAQH-- 128
              .:.|||..:..|...:......: :|||.:|...|:| .|..:.:|||...||.: |..:|  
Yeast    69 --FANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQ-KWFEHLG 130

  Fly   129 --RELFSLFNHKVCGSSDKEVVNGKPAPDIFLVAAGRFGVP-----PKPSDCLVFEDSPNGVTAA 186
              |..:.:        :..:|..|||.|:.:|......|.|     |..|..:||||:|.|:.|.
Yeast   131 IRRPKYFI--------TANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDAPAGIAAG 187

  Fly   187 NSAGMQVV 194
            .:||.:::
Yeast   188 KAAGCKII 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1lNP_477228.1 YcjU 12..220 CDD:223710 52/199 (26%)
HAD_like 16..231 CDD:304363 50/195 (26%)
GPP2NP_010984.3 HAD_ScGPP-like 14..227 CDD:319829 52/200 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X845
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.