DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1l and GS1

DIOPT Version :9

Sequence 1:NP_477228.1 Gene:Gs1l / 33653 FlyBaseID:FBgn0019982 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_568858.1 Gene:GS1 / 835849 AraportID:AT5G57440 Length:240 Species:Arabidopsis thaliana


Alignment Length:226 Identity:109/226 - (48%)
Similarity:145/226 - (64%) Gaps:4/226 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTHCVFDMDGLLLDTERLYTVATEMILEPYGKTYPFEIKEQVMGLQTEPLARFMVEHYEL--PMS 71
            :||.:|||||||||||:.||...|:||..:.|.:.:.:|.::||.:....||..||...:  .:|
plant    14 ITHVIFDMDGLLLDTEKFYTEVQEIILARFNKKFDWSLKAKMMGRKAIEAARIFVEESGISDSLS 78

  Fly    72 WEEYARQQRANTEILMRNAQLMPGAERLLRHLHANKVPFCLATSSGADMVELKTAQHRELFSLFN 136
            .|::..::.:..:.|...::|||||.||::|||...:|.|:||.:.....:|||.:|||||||.:
plant    79 AEDFLVERESMLQDLFPTSELMPGASRLIKHLHVKNIPICIATGTHTRHYDLKTQRHRELFSLMH 143

  Fly   137 HKVCGSSDKEVVNGKPAPDIFLVAAGRFGVPPKPSD-CLVFEDSPNGVTAANSAGMQVVMVPDPR 200
            |.|.| .|.||..||||||.||.||.||...|..|. .|||||:|:||.||.:|||.||||||||
plant   144 HVVRG-DDPEVKQGKPAPDGFLAAARRFKDGPVDSQKVLVFEDAPSGVLAAKNAGMNVVMVPDPR 207

  Fly   201 LSQEKTSHATQVLASLADFKPEQFGLPAFTD 231
            |.......|.|::.||.|||||::|||.|.|
plant   208 LDISHQDVADQIITSLVDFKPEEWGLPPFED 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1lNP_477228.1 YcjU 12..220 CDD:223710 98/210 (47%)
HAD_like 16..231 CDD:304363 104/217 (48%)
GS1NP_568858.1 PLN02811 21..240 CDD:178407 105/219 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 161 1.000 Domainoid score I1261
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8093
Inparanoid 1 1.050 207 1.000 Inparanoid score I1273
OMA 1 1.010 - - QHG57193
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 1 1.000 - - FOG0001355
OrthoInspector 1 1.000 - - otm2505
orthoMCL 1 0.900 - - OOG6_100310
Panther 1 1.100 - - LDO PTHR18901
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.