DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1l and GPP1

DIOPT Version :9

Sequence 1:NP_477228.1 Gene:Gs1l / 33653 FlyBaseID:FBgn0019982 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_567731.1 Gene:GPP1 / 828690 AraportID:AT4G25840 Length:298 Species:Arabidopsis thaliana


Alignment Length:226 Identity:112/226 - (49%)
Similarity:147/226 - (65%) Gaps:4/226 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTHCVFDMDGLLLDTERLYTVATEMILEPYGKTYPFEIKEQVMGLQTEPLARFMVEHYEL--PMS 71
            :||.:|||||||||||:.||...|.||..|.||:.:.:|.::||.:....||..|:...:  .:|
plant    71 ITHVIFDMDGLLLDTEKFYTEVQEKILARYNKTFDWSLKAKMMGRKAIEAARLFVDESGISDSLS 135

  Fly    72 WEEYARQQRANTEILMRNAQLMPGAERLLRHLHANKVPFCLATSSGADMVELKTAQHRELFSLFN 136
            .|::..::.:..:.|...:.|||||.|||||||...:|.|:||.:.....:|||.:|||||||.:
plant   136 AEDFIVERESMLQDLFPTSDLMPGASRLLRHLHGKGIPICIATGTHTRHFDLKTQRHRELFSLMH 200

  Fly   137 HKVCGSSDKEVVNGKPAPDIFLVAAGRF-GVPPKPSDCLVFEDSPNGVTAANSAGMQVVMVPDPR 200
            |.|.| .|.||..||||||.||.|:.|| ..|..|...|||||:|:||.||.:|||.|:||||.|
plant   201 HVVRG-DDPEVKEGKPAPDGFLAASRRFEDGPVDPRKVLVFEDAPSGVQAAKNAGMNVIMVPDSR 264

  Fly   201 LSQEKTSHATQVLASLADFKPEQFGLPAFTD 231
            |.:...:.|.||||||.|||||::|||:|.|
plant   265 LDKSYCNVADQVLASLLDFKPEEWGLPSFQD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1lNP_477228.1 YcjU 12..220 CDD:223710 101/210 (48%)
HAD_like 16..231 CDD:304363 107/217 (49%)
GPP1NP_567731.1 YcjU 74..280 CDD:223710 98/206 (48%)
PLN02811 78..297 CDD:178407 108/219 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 161 1.000 Domainoid score I1261
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8093
Inparanoid 1 1.050 207 1.000 Inparanoid score I1273
OMA 1 1.010 - - QHG57193
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 1 1.000 - - FOG0001355
OrthoInspector 1 1.000 - - otm2505
orthoMCL 1 0.900 - - OOG6_100310
Panther 1 1.100 - - O PTHR18901
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.