DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1l and FMN/FHY

DIOPT Version :9

Sequence 1:NP_477228.1 Gene:Gs1l / 33653 FlyBaseID:FBgn0019982 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_193878.2 Gene:FMN/FHY / 828232 AraportID:AT4G21470 Length:379 Species:Arabidopsis thaliana


Alignment Length:242 Identity:92/242 - (38%)
Similarity:135/242 - (55%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANKVLRKVTHCV-FDMDGLLLDTERLYTVATEMILEPYGKTYPFEIKEQVMGLQTEPLARFMVE 64
            |:|. |:|::.|| .|:||.|::|:.:........|..|||.:......:::|......|..:||
plant     3 MSNS-LKKLSSCVLIDLDGTLINTDGVVGDILRKYLCKYGKQWDGRESLKIVGKTPVEAATTIVE 66

  Fly    65 HYELPMSWEEYARQQRANTEIL-MRNAQL-----MPGAERLLRHLHANKVPFCLATSSGADMVEL 123
            .||||...:|:      |:|.. :.:||:     :|||.||:|||..:.||..||::|....:|.
plant    67 DYELPCKVDEF------NSEFYPLFSAQMDKIKSLPGANRLIRHLKCHGVPVALASNSSRANIES 125

  Fly   124 KTAQH---RELFSLFNHKVCGSSDKEVVNGKPAPDIFLVAAGRFGVPPKPSDCLVFEDSPNGVTA 185
            |.:.|   :|.||:    :.||.  ||..|||:|||||.||.|  :...|:||||.|||..||.|
plant   126 KISYHEGWKECFSV----IVGSD--EVSKGKPSPDIFLEAAKR--LKKDPADCLVIEDSVPGVMA 182

  Fly   186 ANSAGMQVVMVPD-PRLSQEKTSHATQVLASLADFKPEQFGLPAFTD 231
            ..:||.:|:.||. |:.:...|| |.:|:.||.|.:.|::|||.|.|
plant   183 GKAAGTKVIAVPSLPKQTHLYTS-ADEVINSLLDIRLEKWGLPPFQD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1lNP_477228.1 YcjU 12..220 CDD:223710 82/218 (38%)
HAD_like 16..231 CDD:304363 84/224 (38%)
FMN/FHYNP_193878.2 PLN02940 1..379 CDD:178528 92/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.