DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1l and PUDP

DIOPT Version :9

Sequence 1:NP_477228.1 Gene:Gs1l / 33653 FlyBaseID:FBgn0019982 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001129037.1 Gene:PUDP / 8226 HGNCID:16818 Length:251 Species:Homo sapiens


Alignment Length:244 Identity:117/244 - (47%)
Similarity:153/244 - (62%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTHCVFDMDGLLL-----------------------DTERLYTVATEMILEPYGKTYPFEIKEQV 50
            |||.:||||||||                       ||||||:|..:.|...|.|.|.:::|..|
Human     8 VTHLIFDMDGLLLGYTGSIVAAASGESSRGLQSRWTDTERLYSVVFQEICNRYDKKYSWDVKSLV 72

  Fly    51 MGLQTEPLARFMVEHYELPMSWEEYARQQRANTEILMRNAQLMPGAERLLRHLHANKVPFCLATS 115
            ||.:....|:.:::..:||||.||...:.:...:.:...|.||||||:|:.||..:.:||.||||
Human    73 MGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATS 137

  Fly   116 SGADMVELKTAQHRELFSLFNHKVCGSSDKEVVNGKPAPDIFLVAAGRFGVPPKPSDCLVFEDSP 180
            ||:...::||::|:|.||||:|.|.| .|.||.:|||.|||||..|.||..||....||||||:|
Human   138 SGSASFDMKTSRHKEFFSLFSHIVLG-DDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAP 201

  Fly   181 NGVTAANSAGMQVVMVPDPRLSQEKTSHATQVLASLADFKPEQFGLPAF 229
            |||.||.:||||||||||..||::.|:.||.||.||.||:||.||||::
Human   202 NGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSY 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1lNP_477228.1 YcjU 12..220 CDD:223710 107/230 (47%)
HAD_like 16..231 CDD:304363 112/237 (47%)
PUDPNP_001129037.1 PGMB-YQAB-SF 11..217 CDD:213673 93/206 (45%)
HAD_like 15..251 CDD:304363 112/237 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159400
Domainoid 1 1.000 185 1.000 Domainoid score I3400
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8093
Inparanoid 1 1.050 228 1.000 Inparanoid score I3476
Isobase 1 0.950 - 0 Normalized mean entropy S1244
OMA 1 1.010 - - QHG57193
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 1 1.000 - - FOG0001355
OrthoInspector 1 1.000 - - oto89604
orthoMCL 1 0.900 - - OOG6_100310
Panther 1 1.100 - - LDO PTHR18901
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1909
SonicParanoid 1 1.000 - - X845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.