DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1l and pudp

DIOPT Version :9

Sequence 1:NP_477228.1 Gene:Gs1l / 33653 FlyBaseID:FBgn0019982 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_017946702.1 Gene:pudp / 496806 XenbaseID:XB-GENE-946266 Length:240 Species:Xenopus tropicalis


Alignment Length:218 Identity:102/218 - (46%)
Similarity:139/218 - (63%) Gaps:1/218 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CVFDMDGLLLDTERLYTVATEMILEPYGKTYPFEIKEQVMGLQTEPLARFMVEHYELPMSWEEYA 76
            |..:..|:..||||||||..:.|...:||.|.:::|..|||.:..|.|..:.:...|||:.||..
 Frog    23 CNINSSGIKGDTERLYTVVFQEICNRFGKEYTWDVKSLVMGKKALPAAEIIRDVLALPMTAEELL 87

  Fly    77 RQQRANTEILMRNAQLMPGAERLLRHLHANKVPFCLATSSGADMVELKTAQHRELFSLFNHKVCG 141
            .:.|...|.:...|.||||.|:|:.||:.:.:|..:||||.....|:||::|::.|:||:|.|.|
 Frog    88 NESRIKQEEIFPTASLMPGVEKLIYHLNKHNIPIAVATSSAKVTFEMKTSKHKDFFNLFHHIVLG 152

  Fly   142 SSDKEVVNGKPAPDIFLVAAGRFGVPPKPSDCLVFEDSPNGVTAANSAGMQVVMVPDPRLSQEKT 206
             .|.:|.||||.||.|||.|.||..||:...||||||:||||.||.:|||||||:||..|:.:.|
 Frog   153 -DDPDVKNGKPQPDSFLVCAKRFNPPPRLDKCLVFEDAPNGVEAALTAGMQVVMIPDENLNPDLT 216

  Fly   207 SHATQVLASLADFKPEQFGLPAF 229
            ..||.||.|:.:|:||.||||.:
 Frog   217 KKATLVLKSMEEFQPELFGLPPY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1lNP_477228.1 YcjU 12..220 CDD:223710 95/207 (46%)
HAD_like 16..231 CDD:304363 101/214 (47%)
pudpXP_017946702.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3875
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H8093
Inparanoid 1 1.050 200 1.000 Inparanoid score I3666
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 1 1.000 - - FOG0001355
OrthoInspector 1 1.000 - - otm48317
Panther 1 1.100 - - LDO PTHR18901
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.