DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1l and fmn1

DIOPT Version :9

Sequence 1:NP_477228.1 Gene:Gs1l / 33653 FlyBaseID:FBgn0019982 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_588395.1 Gene:fmn1 / 2539192 PomBaseID:SPCC18.16c Length:163 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:26/135 - (19%)
Similarity:46/135 - (34%) Gaps:49/135 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LDTERLYTVATEMILEPY-----GK-TYPFEIKEQVMGLQT--------EPLARF---------- 61
            |:.:|...|..|.:..||     || .:.|....:.:|:.|        :.|.|:          
pombe     5 LEEKRPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYA 69

  Fly    62 MVEHYELPM----SWEEYARQQRANTEI-------------LMRNAQL--------MPGAERLLR 101
            ||:....||    .|..|.:.:..:.|:             :||...|        ..|.::|:.
pombe    70 MVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIE 134

  Fly   102 HLHAN 106
            .:|.:
pombe   135 DIHTD 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1lNP_477228.1 YcjU 12..220 CDD:223710 26/135 (19%)
HAD_like 16..231 CDD:304363 26/135 (19%)
fmn1NP_588395.1 Flavokinase 21..145 CDD:279952 22/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.