DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1l and R151.10

DIOPT Version :9

Sequence 1:NP_477228.1 Gene:Gs1l / 33653 FlyBaseID:FBgn0019982 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001379936.1 Gene:R151.10 / 24104817 WormBaseID:WBGene00020113 Length:233 Species:Caenorhabditis elegans


Alignment Length:229 Identity:92/229 - (40%)
Similarity:127/229 - (55%) Gaps:8/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTHCVFDMDGLLLDTERLYTVATEMILEPYGKTYPFEIKEQVMGLQTEPLARFMVEHYELP--MS 71
            |||.:||.||||:|||..||.|...:|..||..:..::|.:.||.:.:...|:::...::.  ::
 Worm     5 VTHVIFDFDGLLVDTESAYTEANMELLRKYGHVFTMDLKRRQMGKRHDESIRWLINELKIGDLVT 69

  Fly    72 WEEYARQQRANTEILMRNAQLMPGAERLLRHLHANKVPFCLATSSGADMVELKTAQHRELFSLFN 136
            .|||:||.......:.:.:..|||||:|:|||....||..|.|.|.:.....|...|::..::..
 Worm    70 PEEYSRQYDELLIEMFKRSPAMPGAEKLVRHLLHTGVPVALCTGSCSRTFPTKLDNHKDWVNMIK 134

  Fly   137 HKVCGSSDKEVVNGKPAPDIFLVAAGRFGVPPKPSD-CLVFEDSPNGVTAANSAGMQVVMVP--- 197
            .:|....|.||.:|||.||.|||...||...|:.:| .||||||.|||.:|..||||.||||   
 Worm   135 LQVLSGDDPEVKHGKPHPDPFLVTMKRFPQVPESADKVLVFEDSYNGVLSALDAGMQCVMVPERS 199

  Fly   198 --DPRLSQEKTSHATQVLASLADFKPEQFGLPAF 229
              ||....|..:..|.:|.||..||||.||||.:
 Worm   200 IFDPDSDPEFKNRVTVILNSLEQFKPEDFGLPPY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1lNP_477228.1 YcjU 12..220 CDD:223710 81/215 (38%)
HAD_like 16..231 CDD:304363 87/222 (39%)
R151.10NP_001379936.1 HAD_AtGPP-like 5..197 CDD:319831 76/191 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167026
Domainoid 1 1.000 128 1.000 Domainoid score I3303
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I2920
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57193
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 1 1.000 - - FOG0001355
OrthoInspector 1 1.000 - - otm14485
orthoMCL 1 0.900 - - OOG6_100310
Panther 1 1.100 - - LDO PTHR18901
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1909
SonicParanoid 1 1.000 - - X845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.