DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and NAM8

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_011954.1 Gene:NAM8 / 856486 SGDID:S000001128 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:72/217 - (33%)
Similarity:109/217 - (50%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPA----------GYCFVNFISDDHA 61
            ||:||.|:....:|.:...:..:||....||:|.|......:          |||||:|.|..||
Yeast    55 QLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPSSTHA 119

  Fly    62 LDAMHKLNGKPIPGTNPIVRFRLNSASNSYKLPGNE-------REFSVWVGDLSSDVDDYQLYKV 119
            .:|:.| ||..||.. |..:.:||.|::||....|.       ...|::||||:.:|.:.||:::
Yeast   120 ANALLK-NGMLIPNF-PNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDLAPNVTESQLFEL 182

  Fly   120 FSSKFTSIKTAKVILDSL-GFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPKPKS 183
            |.:::.|...||::.|.: |.|||||||:|...|||:.||.:|.| :.|..:.||:         
Yeast   183 FINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQG-VFLNGRAIKV--------- 237

  Fly   184 ELGGAVGE-----GNTNYGYGS 200
              |...|:     ||.:|...|
Yeast   238 --GPTSGQQQHVSGNNDYNRSS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 31/92 (34%)
RRM2_SECp43 99..180 CDD:241056 32/81 (40%)
NAM8NP_011954.1 RRM1_NGR1_NAM8_like 55..144 CDD:410023 30/90 (33%)
RRM2_SECp43_like 162..241 CDD:409781 33/90 (37%)
RRM3_NGR1_NAM8_like 312..383 CDD:409782
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I2591
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001306
OrthoInspector 1 1.000 - - otm46874
orthoMCL 1 0.900 - - OOG6_102296
Panther 1 1.100 - - LDO PTHR47640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1842
SonicParanoid 1 1.000 - - X1010
TreeFam 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.