DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and NGR1

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_009771.3 Gene:NGR1 / 852513 SGDID:S000000416 Length:672 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:62/164 - (37%)
Similarity:90/164 - (54%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGKPIPG---------TNPIVR--FRLN 85
            ||:|.:|       ..||||||.|.:...|..|: .||..|:|.         |||..:  ||||
Yeast   119 DPSTTQL-------HHAGYCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLN 175

  Fly    86 SASNS---YKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILDSL-GFSKGYGFV 146
            .||.:   ..:|... |||::|||||....:..|..:|.::|.|:||.:|:.|.| |.|:.:|||
Yeast   176 WASGA
TLQSSIPSTP-EFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFV 239

  Fly   147 RFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPK 180
            |||.|||::.||.:|:|....| :.:::..|.|:
Yeast   240 RFGDEDERRRALIEMSGKWFQG-RALRVAYATPR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 26/68 (38%)
RRM2_SECp43 99..180 CDD:241056 34/81 (42%)
NGR1NP_009771.3 RRM1_NGR1_NAM8_like 35..180 CDD:410023 26/68 (38%)
RRM2_NGR1_NAM8_like 191..270 CDD:410025 33/79 (42%)
RRM <308..526 CDD:223796
RRM3_NGR1_NAM8_like 359..430 CDD:409782
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I2591
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001306
OrthoInspector 1 1.000 - - otm46874
orthoMCL 1 0.900 - - OOG6_102296
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1842
SonicParanoid 1 1.000 - - X1010
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.