DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and RBP47C'

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_175181.1 Gene:RBP47C' / 841159 AraportID:AT1G47500 Length:434 Species:Arabidopsis thaliana


Alignment Length:215 Identity:81/215 - (37%)
Similarity:125/215 - (58%) Gaps:14/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWMGSLESYMTENFIIAAFRKMGE-DPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGK 71
            :|:|.|:::|.|.::.:||....| :..:::::|||:.|...||.||.|.|.|.|...:.:.||.
plant   105 IWVGDLQNWMDEAYLNSAFTSAEEREIVSLKVIRNKHNGSSEGYGFVEFESHDVADKVLQEFNGA 169

  Fly    72 PIPGTNPIVRFRLNSASNS---YKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVI 133
            |:|.|:.  .||||.||.|   .:|..|..:.|::||||:.||.|..|::.||.|:.|:|.|||:
plant   170 PMPNTDQ--PFRLNWASFS
TGEKRLENNGPDLSIFVGDLAPDVSDALLHETFSEKYPSVKAAKVV 232

  Fly   134 LD-SLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPKPKS---ELGGAVGEGNT 194
            || :.|.||||||||||.|:|:..|:.:||| :...::.::|..|.|:..:   :.||.:..|..
plant   233 LDANTGRSKGYGFVRFGDENERTKAMTEMNG-VKCSSRAMRIGPATPRKTNGYQQQGGYMPSGAF 296

  Fly   195 NYGYGSGMTA---AGGTDYS 211
            ....|..:..   .||.|.|
plant   297 TRSEGDTINTTIFVGGLDSS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 31/82 (38%)
RRM2_SECp43 99..180 CDD:241056 38/81 (47%)
RBP47C'NP_175181.1 RRM1_SECp43_like 104..186 CDD:240790 31/82 (38%)
RRM2_SECp43_like 198..277 CDD:240791 37/79 (47%)
RRM3_NGR1_NAM8_like 305..376 CDD:240792 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D775799at2759
OrthoFinder 1 1.000 - - FOG0001306
OrthoInspector 1 1.000 - - otm2563
orthoMCL 1 0.900 - - OOG6_102296
Panther 1 1.100 - - O PTHR47640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1010
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.