DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and RBP45A

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_568815.1 Gene:RBP45A / 835581 AraportID:AT5G54900 Length:387 Species:Arabidopsis thaliana


Alignment Length:218 Identity:81/218 - (37%)
Similarity:122/218 - (55%) Gaps:27/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGKP 72
            ||:|.|:.:|.||:|::.|.:.|| .|:.:::|||.||:..||.|:.|:|...|...:...||.|
plant    62 LWIGDLQQWMDENYIMSVFAQSGE-ATSAKVIRNKLTGQSEGYGFIEFVSHSVAERVLQTYNGAP 125

  Fly    73 IPGTNPIVRFRLNSASNSYKLPGNER------EFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAK 131
            :|.|..  .||||.|...   .|.:|      :.:::||||:.:|.||.|...|.:.:.|:|.||
plant   126 MPSTEQ--TFRLNWA
QAG---AGEKRFQTEGPDHTIFVGDLAPEVTDYMLSDTFKNVYGSVKGAK 185

  Fly   132 VILD-SLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKI-----CNAVP-KP---KSELG 186
            |:|| :.|.|||||||||..|:||..|:.:|||.. ..|:|::|     .||:| :|   ::..|
plant   186 VVLDRTTGRSKGYGFVRFADENEQMRAMTEMNGQY-CSTRPMRIGPAANKNALPMQPAMYQNTQG 249

  Fly   187 GAVGEGNTNYGYGSGMTAAGGTD 209
            ...|:.:.|    :.....||.|
plant   250 ANAGDNDPN----NTTIFVGGLD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 33/81 (41%)
RRM2_SECp43 99..180 CDD:241056 39/87 (45%)
RBP45ANP_568815.1 RRM1_SECp43_like 61..138 CDD:409780 32/78 (41%)
RRM2_SECp43_like 153..232 CDD:409781 36/79 (46%)
RRM3_NGR1_NAM8_like 259..330 CDD:409782 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D775799at2759
OrthoFinder 1 1.000 - - FOG0001306
OrthoInspector 1 1.000 - - otm2563
orthoMCL 1 0.900 - - OOG6_102296
Panther 1 1.100 - - O PTHR47640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1010
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.