DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and CP31B

DIOPT Version :10

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_199836.1 Gene:CP31B / 835090 AraportID:AT5G50250 Length:289 Species:Arabidopsis thaliana


Alignment Length:179 Identity:49/179 - (27%)
Similarity:87/179 - (48%) Gaps:23/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLWMGSLESYMTENFIIAAFRKMGEDPTTVRL---MRNKYTGEPAGYCFVNFISDDHALDAMHKL 68
            :|::|:|...:....:...|.:.|    ||.:   :.|:.|.:..|:.||...:.:.|..|:.|.
plant   114 KLFVGNLPYDVDSQALAMLFEQAG----TVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKF 174

  Fly    69 NGKPIPGTNPIVRFRLNSASNSYKLPGNERE-------FSVWVGDLSSDVDDYQLYKVFSSKFTS 126
            |...:.|.    |..:|.|:.....|  ||:       |.::||:|..|||..:|.::| |:...
plant   175 NSFEVNGR----RLTVNRAAPRGSRP--ERQPRVYDAAFRIYVGNLPWDVDSGRLERLF-SEHGK 232

  Fly   127 IKTAKVILD-SLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKI 174
            :..|:|:.| ..|.|:|:|||:...|:|...|:..::|. .|..:.||:
plant   233 VVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAALDGQ-NLEGRAIKV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:410022 20/85 (24%)
RRM2_SECp43_like 99..178 CDD:409781 26/84 (31%)
Trnau1ap 210..330 CDD:465438
CP31BNP_199836.1 RRM_SF 114..193 CDD:473069 20/86 (23%)
RRM 208..289 CDD:440488 25/75 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.