DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and AT5G09880

DIOPT Version :10

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_568220.1 Gene:AT5G09880 / 830848 AraportID:AT5G09880 Length:527 Species:Arabidopsis thaliana


Alignment Length:163 Identity:44/163 - (26%)
Similarity:81/163 - (49%) Gaps:9/163 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TENFIIAAFRKMGEDPTTVRLM--RNKYTGEPAGYC-FVNFISDDHALDAMHKL-NGKPIPGTNP 78
            ||..:...|.|.|: ...|||:  ||....:..||. |.:.:|...|:....:| .|:|:. ..|
plant   180 TERDVYEFFSKAGK-VRDVRLIMDRNSRRSKGVGYIEFYDVMSVPMAIALSGQLFLGQPVM-VKP 242

  Fly    79 IVRFRLNSASNSYKLPG-NEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILD-SLGFSK 141
            ....:..:.|||..:.| ...:..::||:|..::.:.||.::|.: |..::..::.|| ..|..|
plant   243 SEAEKNLAQSNSTTVGGTGPADRKLYVGNLHFNMSELQLRQIFEA-FGPVELVQLPLDPETGQCK 306

  Fly   142 GYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKI 174
            |:||::|...:..|:|...:||.:.:..:.||:
plant   307 GFGFIQFVQLEHSKAAQIALNGKLEIAGRTIKV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:410022 20/75 (27%)
RRM2_SECp43_like 99..178 CDD:409781 21/77 (27%)
Trnau1ap 210..330 CDD:465438
AT5G09880NP_568220.1 SF-CC1 85..517 CDD:273721 44/163 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.