DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and ATRBP45C

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_567764.1 Gene:ATRBP45C / 828808 AraportID:AT4G27000 Length:415 Species:Arabidopsis thaliana


Alignment Length:364 Identity:101/364 - (27%)
Similarity:143/364 - (39%) Gaps:122/364 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGKP 72
            ||:|.|:.:|.||:::..|...|| .|..:::|||..|...||.|:.|::...|...:...||.|
plant    82 LWIGDLQPWMDENYLMNVFGLTGE-ATAAKVIRNKQNGYSEGYGFIEFVNHATAERNLQTYNGAP 145

  Fly    73 IPGTNPIVRFRLNSASNSYKLPGNER------EFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAK 131
            :|.:..  .||||.|    :|...||      |.:|:||||:.||.|:.|.:.|.:.::|:|.||
plant   146 MPSSEQ--AFRLNWA----QLGAGERRQAEGPEHTVFVGDLAPDVTDHMLTETFKAVYSSVKGAK 204

  Fly   132 VILD-SLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPK------PKS--ELGG 187
            |:.| :.|.|||||||||..|.||..|:.:|||.. ..::|::...|..|      |.|  ...|
plant   205 VVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQY-CSSRPMRTGPAANKKPLTMQPASYQNTQG 268

  Fly   188 AVGEG---NTNYGYGS--------------------------------------------GMTAA 205
            ..||.   ||....|:                                            .::..
plant   269 NSGESDPTNTTIFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSVL 333

  Fly   206 GGT----------------------DYSQY--------YDPTSTYWQGYQAWQGYYEQAGASITD 240
            .||                      |.:||        |.|     |||:|: ||    .....|
plant   334 NGTQLGGQSIRLSWGRSPSNKQTQPDQAQYGGGGGYYGYPP-----QGYEAY-GY----APPPQD 388

  Fly   241 AAAYYQQAMSQSHSNPQTLAQHAEAWSAQRSAQYEQQQQ 279
            ..|||.......:.|            .|:...|:||||
plant   389 PNAYYGGYAGGGYGN------------YQQPGGYQQQQQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 29/81 (36%)
RRM2_SECp43 99..180 CDD:241056 36/81 (44%)
ATRBP45CNP_567764.1 RRM1_SECp43_like 81..158 CDD:240790 28/78 (36%)
ELAV_HUD_SF 91..346 CDD:273741 75/262 (29%)
RRM2_SECp43_like 172..251 CDD:240791 35/79 (44%)
RRM3_NGR1_NAM8_like 277..348 CDD:240792 5/70 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D775799at2759
OrthoFinder 1 1.000 - - FOG0001306
OrthoInspector 1 1.000 - - otm2563
orthoMCL 1 0.900 - - OOG6_102296
Panther 1 1.100 - - O PTHR47640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1010
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.