DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and GR-RBP2

DIOPT Version :10

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_193121.1 Gene:GR-RBP2 / 827019 AraportID:AT4G13850 Length:158 Species:Arabidopsis thaliana


Alignment Length:147 Identity:45/147 - (30%)
Similarity:65/147 - (44%) Gaps:21/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NGKPIPGTNPIVRFRLNSASNSYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVI 133
            ||. :|.|:.:...||.|.             .:::|.||...||..|...| :.|..:..||||
plant    18 NGN-VPVTSMLGSLRLMST-------------KLFIGGLSWGTDDASLRDAF-AHFGDVVDAKVI 67

  Fly   134 LD-SLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPKPKSEL----GGAVGEGN 193
            :| ..|.|:|:|||.|..|....:|:.:|:|. .|..:.|::..|..:|.:..    ||....|.
plant    68 VDRETGRSRGFGFVNFNDEGAATAAISEMDGK-ELNGRHIRVNPANDRPSAPRAYGGGGGYSGGG 131

  Fly   194 TNYGYGSGMTAAGGTDY 210
            ..||.|.|....||..|
plant   132 GGYGGGGGGYGGGGGGY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:410022 7/20 (35%)
RRM2_SECp43_like 99..178 CDD:409781 26/79 (33%)
Trnau1ap 210..330 CDD:465438 1/1 (100%)
GR-RBP2NP_193121.1 PLN03134 1..143 CDD:178680 42/140 (30%)

Return to query results.
Submit another query.