DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and RBP47B

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_188544.1 Gene:RBP47B / 821447 AraportID:AT3G19130 Length:435 Species:Arabidopsis thaliana


Alignment Length:246 Identity:87/246 - (35%)
Similarity:127/246 - (51%) Gaps:41/246 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGKP 72
            ||:|.|..:|.|.::.:.|...|| .::|:::|||.|.:..||.||.|:|...|.:.:...:|..
plant   110 LWVGDLLHWMDETYLHSCFSHTGE-VSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEVLQNYSGSV 173

  Fly    73 IPGTNPIVRFRLNSASNSYKLPGNER------EFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAK 131
            :|.::.  .||:|.||.|   .|.:|      :.||:|||||.||.|..|::.||.::.|:|:||
plant   174 MPNSDQ--PFRINWASFS
---TGEKRAVENGPDLSVFVGDLSPDVTDVLLHETFSDRYPSVKSAK 233

  Fly   132 VILDS-LGFSKGYGFVRFGIEDEQKSALYDMNG--------YIGLGTKPIKICNAVPKPKSELGG 187
            |::|| .|.||||||||||.|:|:..||.:|||        .:|:.|....|.|........:..
plant   234 VVIDSNTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIATPKRAIANQQQHSSQAVIL 298

  Fly   188 AVGEG-NTNYGYGS--------GMTAAGGTD-----------YSQYYDPTS 218
            |.|.| |.:.||||        .....||.|           :||:.:..|
plant   299 AGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVVS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 28/81 (35%)
RRM2_SECp43 99..180 CDD:241056 42/89 (47%)
RBP47BNP_188544.1 RRM1_SECp43_like 109..189 CDD:409780 28/81 (35%)
RRM2_SECp43_like 201..280 CDD:409781 39/78 (50%)
RRM_SF 320..391 CDD:418427 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D775799at2759
OrthoFinder 1 1.000 - - FOG0001306
OrthoInspector 1 1.000 - - otm2563
orthoMCL 1 0.900 - - OOG6_102296
Panther 1 1.100 - - O PTHR47640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1010
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.