DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and trnau1ap

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_031761024.1 Gene:trnau1ap / 779667 XenbaseID:XB-GENE-5809452 Length:204 Species:Xenopus tropicalis


Alignment Length:337 Identity:81/337 - (24%)
Similarity:111/337 - (32%) Gaps:149/337 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVHCQLWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAM 65
            |||    ||||.||.:|.|:||..||..|||....|:::||:.|....|||||.|...:.|...:
 Frog     1 MAS----LWMGDLEPFMDESFITQAFATMGETIAGVKIIRNRMTEGLPGYCFVQFAQQEAAERCL 61

  Fly    66 HKLNGKPIPGTNPIVRFRLNSASNSYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTA 130
            .||:|||:||.:...||:||.|  .|..|                                    
 Frog    62 LKLHGKPLPGASYNKRFKLNRA--FYAKP------------------------------------ 88

  Fly   131 KVILDSLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPKPKSELGGAVGEGNTN 195
                                                  .:|    |..|||.             
 Frog    89 --------------------------------------PEP----NQNPKPL------------- 98

  Fly   196 YGYGSGMTAAGGTDYSQYYDPTSTYWQGYQAWQGYYEQAGASITDAAAYYQQAMSQSHSNPQTLA 260
                  ||.|  :||:|.::                            ||.|...|..||     
 Frog    99 ------MTQA--SDYTQAFN----------------------------YYSQQFQQMFSN----- 122

  Fly   261 QHAEAWS-AQRSAQYEQQQQQQTASAANGAED-----ENGLVEHKFVLDVDKLNREAIDADRRLY 319
                 |. .|:|..|..||...|||.....|:     |..|.:....||:::.|::.::....||
 Frog   123 -----WKYDQQSGGYSYQQYGDTASTWQAPEETAETAEEALEDPVLQLDINEANKQFMEQSEELY 182

  Fly   320 DALESSKWLPIE 331
            :||....|.|::
 Frog   183 NALMDCHWQPLD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 38/82 (46%)
RRM2_SECp43 99..180 CDD:241056 2/80 (3%)
trnau1apXP_031761024.1 RRM1_SECp43 3..86 CDD:410022 39/88 (44%)
Trnau1ap 105..201 CDD:407550 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9407
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47468
OrthoDB 1 1.010 - - D514475at33208
OrthoFinder 1 1.000 - - FOG0001306
OrthoInspector 1 1.000 - - oto104515
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1010
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.