DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and Dazl

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006244539.1 Gene:Dazl / 680486 RGDID:1591714 Length:298 Species:Rattus norvegicus


Alignment Length:210 Identity:48/210 - (22%)
Similarity:77/210 - (36%) Gaps:52/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SASNSYKLP-GNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILDSLGFSKGYGFVRFG 149
            :.|..|.|| |.....:|:||.:...:|:.:: :.|.:::.|:|..|:|.|..|.|||||||.|.
  Rat    25 TTSQGYVLPEGKIMPNTVFVGGIDVRMDETEI-RSFFARYGSVKEVKIITDRTGVSKGYGFVSFY 88

  Fly   150 IE-DEQKSALYDMNGY-----IGLGTKPIKIC-----------NAVPKPKSELGGAVGEGNTNYG 197
            .: |.||.....:|.:     :|...:...:|           |..|.|:               
  Rat    89 NDVDVQKIVESQINFHGKKLKLGPAIRKQNLCTYHVQPRPLIFNPPPPPQ--------------- 138

  Fly   198 YGSGMTAAGGTDYSQ---YYDPTSTYWQGYQAWQGYYEQAGASITDAAAYYQQAMSQSHSNPQTL 259
            :.|..::.....|.|   ..:|.:.|.|.|..:.       :|.......||..:......||  
  Rat   139 FQSVWSSPNAETYMQPPTMMNPITQYVQAYPPYP-------SSPVQVITGYQLPVYNYQMPPQ-- 194

  Fly   260 AQHAEAWSAQRSAQY 274
                  |.|.....|
  Rat   195 ------WPAGEQRSY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 1/3 (33%)
RRM2_SECp43 99..180 CDD:241056 26/97 (27%)
DazlXP_006244539.1 RRM_DAZL 35..116 CDD:241116 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.