DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and BOLL

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001271290.1 Gene:BOLL / 66037 HGNCID:14273 Length:339 Species:Homo sapiens


Alignment Length:244 Identity:60/244 - (24%)
Similarity:99/244 - (40%) Gaps:54/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PGTNPIVRFRLNSASNSYK----LPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVIL 134
            |..||:....||:.:::.:    :|..     ::||.:....::..|.|.| |::.|:|..|::.
Human    14 PSPNPVSPVPLNNPTSAPRYGTVIPNR-----IFVGGIDFKTNESDLRKFF-SQYGSVKEVKIVN 72

  Fly   135 DSLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPK-----PKSELGGAVG---- 190
            |..|.|||||||.|..:::.:..|.:.. .:....|.:.|..|:.|     |:|.:..|.|    
Human    73 DRAGVSKGYGFVTFETQEDAQKILQEAE-KLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYL 136

  Fly   191 EGNTNYGYGSGMTAAGGTDYSQYYDPTSTY----WQG-------YQAWQGYYEQAGASITDAAAY 244
            ..:|.|.|    |...|..|  ::.|..|.    |..       ....|..|:|        .||
Human   137 TTSTGYPY----TYHNGVAY--FHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQ--------PAY 187

  Fly   245 YQQAMSQSHSN-------PQTLAQHAEAWSAQRSAQYEQQQQQQTASAA 286
            :.|.:.|.|:.       |.|...  ||.:.....|::....|.:||:|
Human   188 HYQGIKQCHTRRWMDSLLPFTKCD--EATTQYLPGQWQWSVPQPSASSA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 5/15 (33%)
RRM2_SECp43 99..180 CDD:241056 23/80 (29%)
BOLLNP_001271290.1 RRM_BOULE 37..117 CDD:241117 24/86 (28%)
RRM <38..>119 CDD:223796 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.