DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and elavl2

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_012819022.1 Gene:elavl2 / 594913 XenbaseID:XB-GENE-491749 Length:390 Species:Xenopus tropicalis


Alignment Length:248 Identity:63/248 - (25%)
Similarity:107/248 - (43%) Gaps:53/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LESYMTENFIIAAFRKMGEDPTTVRLMRNKYT-GEPAGYCFVNFISDDHALDAMHKLNGKPIPGT 76
            |...||:..:.:.|..:|| ..:.:|:|:|.| |:..||.|||:|....|..|::.|||      
 Frog    74 LPQNMTQEELKSLFGSIGE-IESCKLVRDKITEGQSLGYGFVNYIDPKDAEKAINTLNG------ 131

  Fly    77 NPIVRFRLNSASNSYKLPGNE--REFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILDSL-G 138
               :|.:..:...||..|.:.  |:.:::|..|...:...:|.::| |::..|.|:::::|.: |
 Frog   132 ---LRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF-SQYGRIITSRILVDQVTG 192

  Fly   139 FSKGYGFVRFGIEDEQKSALYDMNGYIGLG-TKPI--KICN-------------AVPKPKSELGG 187
            .|:|.||:||....|.:.|:..:||....| |:||  |..|             ....|.....|
 Frog   193 VSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKVNHTILSQLYQSPNRRYPG 257

  Fly   188 AVG--------EGNTNYGYG-----------SGMTAAGGTDYSQYYDPTSTYW 221
            .:.        :...|..||           .|||:..|.::..:   ..|.|
 Frog   258 PLAQQAQRFRLDNLLNMAYGGIKSRFSPMTIDGMTSLAGINFPGH---AGTGW 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 23/77 (30%)
RRM2_SECp43 99..180 CDD:241056 25/97 (26%)
elavl2XP_012819022.1 ELAV_HUD_SF 64..389 CDD:273741 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D775799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.