DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and dazl

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_571599.1 Gene:dazl / 58039 ZFINID:ZDB-GENE-000405-6 Length:229 Species:Danio rerio


Alignment Length:148 Identity:45/148 - (30%)
Similarity:67/148 - (45%) Gaps:21/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SNSYKLP-GNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILDSLGFSKGYGFVRFGIE 151
            ||.|.|| |.....:::||.:...||:.:: :.|.:|:.|:|..|:|....|..||||||.|. |
Zfish    34 SNGYILPEGKMTPNTLFVGGIDMKVDENEI-REFFAKYGSVKEVKIITYRGGICKGYGFVYFS-E 96

  Fly   152 DEQKSALYDMNGYIGLGTKPIKICNAVPKPKSE-------LGGAVGEGNTNYGYGS----GMTA- 204
            |.....:.|..  |....|.:|:..|:.|.:|.       :|.:.....|.|.|.|    |:.. 
Zfish    97 DVDIQTIVDQP--ISFKGKKLKLGPAIMKERSSRSVSSPMIGPSQWVNPTPYMYCSCCPPGLAPP 159

  Fly   205 ----AGGTDYSQYYDPTS 218
                :||..|.|.|..:|
Zfish   160 SPVFSGGNQYMQPYSYSS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 1/1 (100%)
RRM2_SECp43 99..180 CDD:241056 25/80 (31%)
dazlNP_571599.1 RRM <40..>132 CDD:223796 29/95 (31%)
RRM_DAZL 42..123 CDD:241116 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.