DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and CG34354

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster


Alignment Length:378 Identity:89/378 - (23%)
Similarity:143/378 - (37%) Gaps:124/378 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGKP 72
            :::|.|.:.:....:..||...|| .:..|::|:..|.:..||.||:|:....|..|:..:||:.
  Fly    98 IFVGDLSAEIETQQLKDAFTPFGE-ISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQW 161

  Fly    73 IPGTNPIVRFRLNSASNSYKLPGNEREF-------------------SVWVGD----LSSDVDDY 114
            : |:..|   |.|.|:.  |.|..:.:.                   :|:.|.    ||..:::.
  Fly   162 L-GSRSI---RTNW
ATR--KPPATKADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEE 220

  Fly   115 QLYKVFSSKFTSIKTAKVILDSLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKIC---- 175
            .|.|.| |.:.:|:..:|..|     |||.||||..::....|:..:|. ..:..:|:|..    
  Fly   221 ILQKTF-SPYGTIQEIRVFKD-----KGYAFVRFSTKEAATHAIVAVNN-TEINQQPVKCAWGKE 278

  Fly   176 NAVPKPKSEL-GGAVGEGNTNYGYGSGMTAAGGTDYSQ-----YYDPTSTY-----------WQG 223
            :..|...|.: |||:.:|   :.:||...||....|.|     :|.|..||           .|.
  Fly   279 SGDPNHMSAIAGGALAQG---FPFGSAAAAAAAAAYGQQVAGYWYPPAPTYPAAAPASALQPGQF 340

  Fly   224 YQAWQGY-------YEQA-------------------------------------GASITDAAAY 244
            .|..||:       |:||                                     |:::..||..
  Fly   341 LQGMQGFTYGQFAGYQQAGYMGMGVQLPGTWQSVPPQPQLASAAAATAPQITQSVGSALPQAAGV 405

  Fly   245 YQQAMSQSHSNPQTLAQHAEAWSA----------------QRSAQYEQQQQQQ 281
            ....|.|...:|| ||:  :.|.|                |:..|.:||||||
  Fly   406 VAYPMQQFQVSPQ-LAE--DEWLAPSLLVXLPXGMAMYPTQQHQQQQQQQQQQ 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 23/81 (28%)
RRM2_SECp43 99..180 CDD:241056 22/107 (21%)
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 21/77 (27%)
RRM3_TIA1_like 202..278 CDD:240800 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.