DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and Boll

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006245003.1 Gene:Boll / 501143 RGDID:1559527 Length:340 Species:Rattus norvegicus


Alignment Length:200 Identity:50/200 - (25%)
Similarity:82/200 - (41%) Gaps:41/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PGTNPIVRFRLNSASNSYK----LPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVIL 134
            |..||:....||:.::..:    :|..     ::||.:....::..|.|.| |::.|:|..|::.
  Rat    20 PSPNPVSPVPLNNPTSGPRYGTVIPNR-----IFVGGIDFKTNENDLRKFF-SQYGSVKEVKIVN 78

  Fly   135 DSLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPK-----PKSELGGAVG---- 190
            |..|.||||||:.|..:::.:..|.:.. .:....|.:.|..|:.|     |:|.:..|.|    
  Rat    79 DRAGVSKGYGFITFETQEDAQKILQEAE-KLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYL 142

  Fly   191 EGNTNYGYGSGMTAAGGTDYSQYYDPTST--YWQG-------YQAWQGYYEQAGASITDAAAYYQ 246
            ..:|.|.|    |...|..|....:.||.  .|..       ....|..|:|        .||:.
  Rat   143 TTSTGYPY----TYHNGVAYFHTPEVTSVPPSWPSRSISSSPVMVAQPVYQQ--------PAYHY 195

  Fly   247 QAMSQ 251
            ||.:|
  Rat   196 QAPAQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 5/15 (33%)
RRM2_SECp43 99..180 CDD:241056 22/80 (28%)
BollXP_006245003.1 RRM_BOULE 43..123 CDD:410074 23/86 (27%)
PABP-1234 <45..293 CDD:130689 43/174 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.