DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and Hrb98DE

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster


Alignment Length:217 Identity:52/217 - (23%)
Similarity:92/217 - (42%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNF----ISDDHALDAMHK 67
            :|::|.|:...|:..:.|.|.|.| :...|.:|::..|....|:.|:.:    :.|:......||
  Fly    32 KLFIGGLDYRTTDENLKAHFEKWG-NIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHK 95

  Fly    68 LNGKPIPGTNPIVRFRLNS--ASNSYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTA 130
            ::|:.:.....:.|..::|  |..:.|        .::||.|..|.|:..:...| ..|.:|...
  Fly    96 IDGRVVEPKRAVPRQDIDSPNAGATVK--------KLFVGALKDDHDEQSIRDYF-QHFGNIVDI 151

  Fly   131 KVILD-SLGFSKGYGFVRFGIEDE------QKSALYDMNGYIGLGTKPIKICNAVPKPKSELGGA 188
            .:::| ..|..:|:.||.|...|.      ||.  :.:||      |.:.:..|:||...:.||.
  Fly   152 NIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQ--HQLNG------KMVDVKKALPKQNDQQGGG 208

  Fly   189 VGEGNTNYGYGSGMTAAGGTDY 210
            .|.|......|......||.:|
  Fly   209 GGRGGPGGRAGGNRGNMGGGNY 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 20/88 (23%)
RRM2_SECp43 99..180 CDD:241056 21/87 (24%)
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 17/77 (22%)
RRM_SF 123..195 CDD:302621 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.