DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and elavl2

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001002172.2 Gene:elavl2 / 431719 ZFINID:ZDB-GENE-040704-9 Length:389 Species:Danio rerio


Alignment Length:177 Identity:55/177 - (31%)
Similarity:93/177 - (52%) Gaps:18/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGKPIPGTN 77
            |...||:..:.:.|..:|| ..:.:|:|:|.||:..||.|||::....|..|::.|||       
Zfish    75 LPQNMTQEELKSLFGSIGE-IESCKLVRDKITGQSLGYGFVNYMEPKDAEKAINTLNG------- 131

  Fly    78 PIVRFRLNSASNSYKLPGNE--REFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILDSL-GF 139
              :|.:..:...||..|.:.  |:.:::|..|...:...:|.::| |:|..|.|:::::|.: |.
Zfish   132 --LRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF-SQFGRIITSRILVDQVTGV 193

  Fly   140 SKGYGFVRFGIEDEQKSALYDMNGYIGLG-TKPI--KICNAVPKPKS 183
            |:|.||:||....|.:.|:..:||....| |:||  |..|. |..||
Zfish   194 SRGVGFIRFDRRVEAEEAIKGLNGQKPPGATEPITVKFANN-PSQKS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 22/76 (29%)
RRM2_SECp43 99..180 CDD:241056 26/84 (31%)
elavl2NP_001002172.2 ELAV_HUD_SF 65..388 CDD:273741 55/177 (31%)
RRM1_Hu 67..144 CDD:241094 23/78 (29%)
RRM2_HuB 149..238 CDD:241219 28/90 (31%)
RRM_SF 303..388 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D775799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.