DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and SLIRP2

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:70 Identity:25/70 - (35%)
Similarity:36/70 - (51%) Gaps:11/70 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NSYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILD-SLGFSKGYGFVRFGIED 152
            :||||         :||:|...:...:| :.:.||:..:..|:|:.| .||.||.||||.|...|
  Fly     8 SSYKL---------FVGNLPWTIGSKEL-RTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRD 62

  Fly   153 EQKSA 157
            ...||
  Fly    63 AFNSA 67

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity