DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and CG2931

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster


Alignment Length:163 Identity:45/163 - (27%)
Similarity:76/163 - (46%) Gaps:37/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VNFISDDHALDAMHKLNGKPIPGTNPIVR-----FRLNSASNSYKLPGNER-------------- 98
            :|.:|.| ....:.||..:. .|.|||..     .|.:||..|::....::              
  Fly   123 INAVSFD-VTQKLKKLKAEK-SGPNPIAEEAIKAARASSALQSFQTTERKKKDRKTVRIAGGTVW 185

  Fly    99 -----------EFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILDS-LGFSKGYGFVRFGIE 151
                       :|.::.|||.:||:|..|.:.| :||.|.:.|:|:.|. .|.|||:|||.|...
  Fly   186 EDTSLADWPDDDFRIFCGDLGNDVNDEVLTRTF-NKFPSFQRARVVRDKRTGKSKGFGFVSFREP 249

  Fly   152 DEQKSALYDMNG-YIGLGTKPIKICNAVPKPKS 183
            .:...|:.:|:| |:  |::|||:..:..:.:|
  Fly   250 ADFIRAMKEMDGRYV--GSRPIKLRKSTWRQRS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 12/41 (29%)
RRM2_SECp43 99..180 CDD:241056 31/82 (38%)
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 31/84 (37%)
RRM <194..>280 CDD:223796 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.